
ACTH(1-39) human
$197.00 - $2,743.00
All products have special prices for bulk purchase, please contact for more details if required.
Cat. No.: AC139-1 (for 1mg)
Cat. No.: AC139-5 (for 5mg)
Cat. No.: AC139-25 (for 25mg)
Alternative names
Adrenocorticotropic Hormone 1-39, human;Corticotropin
Description
Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed. ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.
Purity
>95%(HPLC)
CAS Number
12279-41-3
Molecular Formula
C207H308N56O58S
Molecular Weight
4541.1
Sequence
(Three-Letter Code) Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
(One-Letter Code) SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Source
Synthetic
Reconstitution
Resuspend in water, at a concentration of ≥10mg/ml. DMSO may have high solubility, and sometimes need be sonicated. Notes: Above are relevant information that may provide a guideline on how to dissolve this peptide. Solubility may vary from batch to batch due to solvent of crystallization, residual solvent content, polymorphism, salt versus free form, degree of hydration, solvent temperature, and dissolved oxygen. End users need to test the solvents & solubility and adapt to their own specific applications.
Storage
Store at -20°C or below, valid for at least one year. Since each freeze-thaw cycle of the peptide can cause partial inactivation, after preparing the corresponding concentration of storage solution for the first time (please prepare the storage solution according to the information in the Reconstitution section of the product description), it should be aliquoted and stored at -20°C or below to avoid repeated freeze-thaw cycles.
Notes
- This product is a lyophilized powder. Due to the deposition of trace amounts of peptides inside the vial during the lyophilization process, a thin or invisible layer of peptides may form. Therefore, before opening the vial, we recommend centrifuging at approximately 8,000-12,000g for 10-30 seconds in a centrifuge to collect the peptides adhered to the vial cap or wall at the bottom of the vial.
- This product is intended for scientific research by professionals only and should not be used for clinical diagnosis or treatment, food or drugs, and should not be stored in a regular household.
- For your safety and health, please wear laboratory attire and disposable gloves while handling.
Related:
SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.
Only for research and not intended for treatment of humans or animals
Journals Using SBS Genetech Products Universities Using SBS Genetech Products
SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory