
Rabbit IgG lambda, his tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: RIGLH-25 (for 25μg)
Cat. No.: RIGLH-50 (for 50μg)
Cat. No.: RIGLH-100 (for 100μg)
Description
Immunoglobulin G (IgG) is a type of antibody that represents approximately 75% of serum antibodies in humans, making it the most common antibody in blood circulation. IgG molecules are produced and released by plasma B cells. Mammalian immunoglobulins feature two classes of light chains: lambda and kappa. These light chains typically exist in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.
Species
Rabbit
Expression Sequence
Protein sequence (with C-10*His)
QPAVTPSVILFPPSSEELKDNKATLVCLINDFYPGTVKVNWKADGTPVTQGVDTTQPSKQSNSKYAASSFLSLSANQWKSYQSVTCQVTHEGHTVEKSLAPAECSGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Predicted MW: 13.0 kDa
Observed MW: 17.0 kDa
Purity
>95% by SDS-PAGE
Tag
with C-10*His
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.