
Parathyroid Hormone Fragment 28-48 human
$1,904.00 - $2,744.00
$3,430.00
All products have special prices for bulk purchase, please contact for more details if required.
Cat. No.: PTHH-5 (for 5mg)
Cat. No.: PTHH-10 (for 10mg)
Cat. No.: PTHH-50 (for 50mg)
Cat. No.: PTHH-100 (for 100mg)
English Name: Parathyroid Hormone Fragment 28-48 human
Single Letter: H2N-QEEEEETAGAPQGLFRGSEINFMHNLGKHLSSMERVEWLRKKLQDVHNF-OH
Three Letter: H2N-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Arg-Gly-Ser-Glu-Ile-Asn-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-COOH
Amino Acid Count: 49
Molecular Formula: C251H388N74O78S2
Average Molecular Weight: 5754.35
Isoelectric Point (pI): 5.56
Net Charge at pH 7.0: -2.31
Average Hydrophilicity: 0.38409090909091
Hydrophobicity Value: -0.96
Appearance: White powdery solid
Extinction Coefficient: 5500
Source: Synthetic, for scientific research use only, not for human use.
Purity: 95%, 98%
Salt Form Options: TFA, HAC, HCl, or others
Storage Conditions: -20°C to -80°C

SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.
Only for research and not intended for treatment of humans or animals

Journals Using SBS Genetech Products Universities Using SBS Genetech Products

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory








