thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Nesfatin-1(mouse) | 917528-36-0

Nesfatin-1(mouse) | 917528-36-0

$2,408.00 - $3,920.00
$4,900.00
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact for more details if required.

 

Cat. No.: NFTM-5 (for 5mg)

Cat. No.: NFTM-10 (for 10mg)

Cat. No.: NFTM-50 (for 50mg)

Cat. No.: NFTM-100 (for 100mg)

 


English Name: Nesfatin-1(mouse)
CAS Number: 917528-36-0

Single Letter Amino Acid Sequence:
H2N-VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGR-OH

Three Letter Amino Acid Sequence:
H2N-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Thr-Glu-Pro-Val-Glu-Asn-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-COOH

Amino Acids Count: 63

Molecular Formula: C327H518N88O106
Average Molecular Weight: 7378.14
Exact Molecular Weight: 7373.78

Isoelectric Point (pI): 5.15
Net Charge at pH 7.0: -2.54

Average Hydrophilicity: 0.56428571428571
Hydrophobicity Value: -0.89

Extinction Coefficient: 4470

Source: Synthetic, for scientific research use only, not for human use.
Storage Conditions: -20°C to -80°C

 

SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.

 

 

 

Only for research and not intended for treatment of humans or animals

 

 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

    Congratulations to Our Customer! Ultra-Sensitive HPV DNA Detection Method Published in Biosensors and Bioelectronics (IF: 11)
    20 de março de 2026
    Human papillomavirus (HPV) is a group of non-enveloped, double-stranded DNA viruses strongly...
    Read more...
    Congratulations to Our Customer! Marine Microbial Degradation of SCCPs Revealed in Water Research (IF: 12)
    9 de janeiro de 2026
    Short-chain chlorinated paraffins (SCCPs), a class of persistent organic pollutants (POPs), pose...
    Read more...
    Congratulations to Our Customer! Breakthrough Research on HOXB3 Condensation as a Potential Target in Glioblastoma Published in Nature Cell Biology (IF 19)
    5 de novembro de 2025
    Glioblastoma (GBM) remains one of the most aggressive and lethal primary brain tumors in adults,...
    Read more...
    More Posts

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More