
Mouse TMEM119, His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: MT119H-25 (for 25μg)
Cat. No.: MT119H-50 (for 50μg)
Cat. No.: MT119H-100 (for 100μg)
Description
TMEM119, hailed as a microglia-specific transmembrane molecule, boasts robust expression unparalleled by other macrophages, immune cells, or neurons. This distinction renders it the foremost contender for microglia identification. Since its discovery, TMEM119 has emerged as a stalwart immunohistochemical marker for microglia in neurodegenerative diseases. Recently, an adapted protocol has even facilitated TMEM119 staining in postmortem cerebrospinal fluid samples from trauma cases, further underscoring its versatility and clinical utility.
Species
Mouse
Molecular Alias
Osteoblast induction factor (OBIF)
Accession
Q8R138
Expression Sequence
Protein sequence(Q8R138, Thr100-Val280, with C-10*His)
TFLIMFIVCAALITRQKHKATAYYPSSFPEKKYVDQRDRAGGPRTFSEVPDRAPDSRHEEGLDTSHQLQADILAATQNLRSPARALPGNGEGAKPVKGGSEEEEEEVLSGQEEAQEAPVCGVTEEKLGVPEESVSAEAEGVPATSEGQGEAEGSFSLAQESQGATGPPESPCACNRVSPSVGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 20.8kDa
Actual: 28kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.