All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HT2N4H-25 (for 25μg)

Cat. No.: HT2N4H-50 (for 50μg)

Cat. No.: HT2N4H-100 (for 100μg)

Description

Tau proteins (short for tubulin associated unit) are a group of six highly soluble protein isoforms produced through alternative splicing of the MAPT gene (microtubule-associated protein tau). These proteins primarily maintain the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), with the highest concentration in the cerebral cortex. Hyperphosphorylation of tau proteins (resulting in tau inclusions, or pTau) can lead to the self-assembly of tangles composed of paired helical filaments and straight filaments, contributing to the pathogenesis of Alzheimer's disease, frontotemporal dementia, and other tauopathies.

Species

Human

Molecular Alias

Neurofibrillary tangle protein, Paired helical filament-tau (PHF-tau)

Accession

P10636-8

Expression Sequence

Protein sequence(P10636-8, Gln6-Lys24&Thr111-Lys130&Ala152-Arg170&Ser185-Gly204, with C-10*His)

QEFEVMEDHAGTYGLGDRKGGGGSTPSLEDEAAGHVTQARMVSKGGGGSATPRGAAPPGQKGQANATRGGGGSSGEPPKSGDRSGYSSPGSPGGGGGSHHHHHHHHHH

Expression Host

E.coli

Molecular Weight

Theoretical: 10.5kDa 

Actual: 11kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

with C-10*His

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.