
Human Tau (2N4R), His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HT2N4H-25 (for 25μg)
Cat. No.: HT2N4H-50 (for 50μg)
Cat. No.: HT2N4H-100 (for 100μg)
Description
Tau proteins (short for tubulin associated unit) are a group of six highly soluble protein isoforms produced through alternative splicing of the MAPT gene (microtubule-associated protein tau). These proteins primarily maintain the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), with the highest concentration in the cerebral cortex. Hyperphosphorylation of tau proteins (resulting in tau inclusions, or pTau) can lead to the self-assembly of tangles composed of paired helical filaments and straight filaments, contributing to the pathogenesis of Alzheimer's disease, frontotemporal dementia, and other tauopathies.
Species
Human
Molecular Alias
Neurofibrillary tangle protein, Paired helical filament-tau (PHF-tau)
Accession
P10636-8
Expression Sequence
Protein sequence(P10636-8, Gln6-Lys24&Thr111-Lys130&Ala152-Arg170&Ser185-Gly204, with C-10*His)
QEFEVMEDHAGTYGLGDRKGGGGSTPSLEDEAAGHVTQARMVSKGGGGSATPRGAAPPGQKGQANATRGGGGSSGEPPKSGDRSGYSSPGSPGGGGGSHHHHHHHHHH
Expression Host
E.coli
Molecular Weight
Theoretical: 10.5kDa
Actual: 11kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
with C-10*His
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.