thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human S100B, His Tag

Human S100B, His Tag

$504.00 - $3,528.00
$4,410.00
S100 calcium-binding protein B (S100B) is a member of the S-100 protein family. These proteins are found in the cytoplasm and nucleus of a wide range of cells and are involved in regulating various cellular processes, such as cell cycle progression and differentiation. S100B is glial-specific and is primarily expressed by astrocytes, although not all astrocytes produce S100B. Research has shown that S100B is specifically expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the past decade, S100B has emerged as a potential peripheral biomarker for blood–brain barrier (BBB) permeability and central nervous system (CNS) injury.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HS100BH-50 (for 50μg)

Cat. No.: HS100BH-100 (for 100μg)

Cat. No.: HS100BH-500 (for 500μg)

Cat. No.: HS100BH-1k (for 1mg)

 

 

Description

S100 calcium-binding protein B (S100B) is a member of the S-100 protein family. These proteins are found in the cytoplasm and nucleus of a wide range of cells and are involved in regulating various cellular processes, such as cell cycle progression and differentiation. S100B is glial-specific and is primarily expressed by astrocytes, although not all astrocytes produce S100B. Research has shown that S100B is specifically expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the past decade, S100B has emerged as a potential peripheral biomarker for blood–brain barrier (BBB) permeability and central nervous system (CNS) injury.

 

Species

Human

 

Molecular Alias

S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B

 

Accession

P04271

 

Expression Sequence

Protein sequence(P04271, Ser2-Glu92 with C-10*His)

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH

 

Expression Host

E.coli

 

Molecular Weight

Theoretical: 12.4kDa 

Actual: 12kDa

 

Purity

95% by SDS-PAGE

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More