![Human S100B, His Tag](https://user-images.strikinglycdn.com/res/hrscywv4p/image/upload/c_limit,fl_lossy,h_1000,w_500,f_auto,q_auto/2311560/327637_508188.png)
Human S100B, His Tag
$504.00 - $3,528.00
$4,410.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HS100BH-50 (for 50μg)
Cat. No.: HS100BH-100 (for 100μg)
Cat. No.: HS100BH-500 (for 500μg)
Cat. No.: HS100BH-1k (for 1mg)
Description
S100 calcium-binding protein B (S100B) is a member of the S-100 protein family. These proteins are found in the cytoplasm and nucleus of a wide range of cells and are involved in regulating various cellular processes, such as cell cycle progression and differentiation. S100B is glial-specific and is primarily expressed by astrocytes, although not all astrocytes produce S100B. Research has shown that S100B is specifically expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the past decade, S100B has emerged as a potential peripheral biomarker for blood–brain barrier (BBB) permeability and central nervous system (CNS) injury.
Species
Human
Molecular Alias
S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B
Accession
P04271
Expression Sequence
Protein sequence(P04271, Ser2-Glu92 with C-10*His)
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH
Expression Host
E.coli
Molecular Weight
Theoretical: 12.4kDa
Actual: 12kDa
Purity
95% by SDS-PAGE
Label
Unconjugated
Tag
His Tag
Form
Lyophilized Powder
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt, at -20 to -70 °C as supplied.
1 month, at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.