thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human RUNX1, His tag

Human RUNX1, His tag

$70.00 - $2,240.00
$2,800.00
Runt-related transcription factor 1 (RUNX1), also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2), is a protein encoded by the RUNX1 gene in humans. RUNX1 acts as a transcription factor, regulating the differentiation of hematopoietic stem cells into mature blood cells. Additionally, it plays a significant role in the development of neurons involved in pain transmission. Belonging to the Runt-related transcription factor (RUNX) family, RUNX1 is also referred to as core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ, which enhances DNA binding and stability of the complex.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HRX1H-10 (for 10μg)

Cat. No.: HRX1H-50 (for 50μg)

Cat. No.: HRX1H-100 (for 100μg)

Cat. No.: HRX1H-500 (for 500μg)

Cat. No.: HRX1H-1 (for 1mg)

 

Description

Runt-related transcription factor 1 (RUNX1), also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2), is a protein encoded by the RUNX1 gene in humans. RUNX1 acts as a transcription factor, regulating the differentiation of hematopoietic stem cells into mature blood cells. Additionally, it plays a significant role in the development of neurons involved in pain transmission. Belonging to the Runt-related transcription factor (RUNX) family, RUNX1 is also referred to as core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ, which enhances DNA binding and stability of the complex.

 

Species

Human

 

Molecular Alias

Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2

 

Accession

Q01196

 

Expression Sequence

Protein sequence(Q01196 Ser50-Leu183, with C-10*His)

SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH

 

Expression Host

E.coli

 

Molecular Weight

Theoretical:16.7kDa 

Actual: 17kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.

 

Reconstitution Method

Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from date of receipt, -20 to -70 °C as supplied.

6 months, -20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More