
Human RUNX1, His tag
$70.00 - $2,240.00
$2,800.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HRX1H-10 (for 10μg)
Cat. No.: HRX1H-50 (for 50μg)
Cat. No.: HRX1H-100 (for 100μg)
Cat. No.: HRX1H-500 (for 500μg)
Cat. No.: HRX1H-1 (for 1mg)
Description
Runt-related transcription factor 1 (RUNX1), also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2), is a protein encoded by the RUNX1 gene in humans. RUNX1 acts as a transcription factor, regulating the differentiation of hematopoietic stem cells into mature blood cells. Additionally, it plays a significant role in the development of neurons involved in pain transmission. Belonging to the Runt-related transcription factor (RUNX) family, RUNX1 is also referred to as core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ, which enhances DNA binding and stability of the complex.
Species
Human
Molecular Alias
Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2
Accession
Q01196
Expression Sequence
Protein sequence(Q01196 Ser50-Leu183, with C-10*His)
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH
Expression Host
E.coli
Molecular Weight
Theoretical:16.7kDa
Actual: 17kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Label
Unconjugated
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.
Reconstitution Method
Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.