All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HRX1H-10 (for 10μg)

Cat. No.: HRX1H-50 (for 50μg)

Cat. No.: HRX1H-100 (for 100μg)

Cat. No.: HRX1H-500 (for 500μg)

Cat. No.: HRX1H-1 (for 1mg)

Description

Runt-related transcription factor 1 (RUNX1), also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2), is a protein encoded by the RUNX1 gene in humans. RUNX1 acts as a transcription factor, regulating the differentiation of hematopoietic stem cells into mature blood cells. Additionally, it plays a significant role in the development of neurons involved in pain transmission. Belonging to the Runt-related transcription factor (RUNX) family, RUNX1 is also referred to as core binding factor-α (CBFα). RUNX proteins form a heterodimeric complex with CBFβ, which enhances DNA binding and stability of the complex.

Species

Human

Molecular Alias

Acute myeloid leukemia 1 protein, Core-binding factor subunit alpha-2 (CBF-alpha-2), Oncogene AML-1,PEA2-alpha B,PEBP2-alpha B, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit, AML1, CBFA2

Accession

Q01196

Expression Sequence

Protein sequence(Q01196 Ser50-Leu183, with C-10*His)

SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLGGGGSHHHHHHHHHH

Expression Host

E.coli

Molecular Weight

Theoretical:16.7kDa 

Actual: 17kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Label

Unconjugated

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution Method

Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from date of receipt, -20 to -70 °C as supplied.

6 months, -20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.