thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human PRL, His tag

Human PRL, His tag

$644.00 - $1,008.00
$1,260.00
Prolactin (PRL), also known as lactotropin, is a protein primarily recognized for its role in enabling mammals to produce milk. It is secreted by the pituitary gland in response to stimuli such as eating, mating, estrogen treatment, ovulation, and nursing, with secretion occurring in pulses between these events. Beyond its role in lactation, prolactin is crucial for metabolism, immune system regulation, and pancreatic development. Prolactin levels are often checked as part of a sex hormone workup because elevated prolactin can suppress the secretion of follicle-stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and potentially causing erectile dysfunction. Additionally, prolactin levels can help distinguish epileptic seizures from psychogenic non-epileptic seizures, as serum prolactin typically rises following an epileptic seizure.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HPRLH-50 (for 50μg)

Cat. No.: HPRLH-100 (for 100μg)

 

 

Description

Prolactin (PRL), also known as lactotropin, is a protein primarily recognized for its role in enabling mammals to produce milk. It is secreted by the pituitary gland in response to stimuli such as eating, mating, estrogen treatment, ovulation, and nursing, with secretion occurring in pulses between these events. Beyond its role in lactation, prolactin is crucial for metabolism, immune system regulation, and pancreatic development. Prolactin levels are often checked as part of a sex hormone workup because elevated prolactin can suppress the secretion of follicle-stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and potentially causing erectile dysfunction. Additionally, prolactin levels can help distinguish epileptic seizures from psychogenic non-epileptic seizures, as serum prolactin typically rises following an epileptic seizure.

 

Species

Human

 

Molecular Alias

Prolactin, Lactotropin

 

Accession

P01236

 

Expression Sequence

Protein sequence(P01236, Leu29-Cys227, with C-10*His)

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 24.5kDa 

Actual:25,28kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More