thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human PIGF, His tag

Human PIGF, His tag

$595.00 - $3,808.00
$4,760.00
Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family, which plays a key role in angiogenesis and vasculogenesis, particularly during embryogenesis. The primary source of PIGF during pregnancy is the placental trophoblast, though it is also expressed in various other tissues, including the villous trophoblast. PIGF expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. In women with preeclampsia, serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HPIGFH-50 (for 50μg)

Cat. No.: HPIGFH-100 (for 100μg)

Cat. No.: HPIGFH-500 (for 500μg)

 

 

Description

Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family, which plays a key role in angiogenesis and vasculogenesis, particularly during embryogenesis. The primary source of PIGF during pregnancy is the placental trophoblast, though it is also expressed in various other tissues, including the villous trophoblast. PIGF expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. In women with preeclampsia, serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered.

 

Species

Human

 

Molecular Alias

PLGF

 

Accession

P49763-2

 

Expression Sequence

Protein sequence (P49763-2, Leu19-Arg149, with C-10*His)

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 16.4kDa 

Actual: 30kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More