thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human PAPP-A, His Tag

Human PAPP-A, His Tag

$280.00 - $448.00
$560.00
Pappalysin-1, also known as pregnancy-associated plasma protein A (PAPPA), is a protein encoded by the PAPPA gene in humans. This secreted protease primarily targets insulin-like growth factor binding proteins. Pappalysin-1 is also employed in screening tests for Down syndrome. Its proteolytic function is activated upon binding to collagen, and it is believed to play a role in local proliferative processes such as wound healing and bone remodeling. Additionally, low plasma levels of PAPPA have been suggested as a biochemical marker for pregnancies involving aneuploid fetuses (fetuses with an abnormal number of chromosomes).
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HPAPPAH-50 (for 50μg)

Cat. No.: HPAPPAH-100 (for 100μg)

 

 

Description

Pappalysin-1, also known as pregnancy-associated plasma protein A (PAPPA), is a protein encoded by the PAPPA gene in humans. This secreted protease primarily targets insulin-like growth factor binding proteins. Pappalysin-1 is also employed in screening tests for Down syndrome. Its proteolytic function is activated upon binding to collagen, and it is believed to play a role in local proliferative processes such as wound healing and bone remodeling. Additionally, low plasma levels of PAPPA have been suggested as a biochemical marker for pregnancies involving aneuploid fetuses (fetuses with an abnormal number of chromosomes).

 

Species

Human

 

Molecular Alias

Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)

 

Accession

Q13219

 

Expression Sequence

Protein sequence (Q13219, Pro1200-Gly1627, with C-10*His):

PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 48.8 kDa

Actual: 65 kDa

 

Purity

95% by SDS-PAGE

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More