
Human NF-H (Neurofilament heavy polypeptide), His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HNFHH-25 (for 25μg)
Cat. No.: HNFHH-50 (for 50μg)
Cat. No.: HNFHH-100 (for 100μg)
Description
Neurofilament heavy polypeptide (NEFH) is a protein encoded by the NEFH gene in humans. This gene produces a heavy subunit protein that, along with medium and light subunits, forms neurofilaments. These neurofilaments constitute the structural framework of nerve cells. Mutations in the NEFH gene are linked to Charcot-Marie-Tooth disease. NEFH is crucial for the formation of the neuronal cytoskeleton, and polymorphisms in this gene are identified as a rare cause of sporadic amyotrophic lateral sclerosis (sALS).
Species
Human
Molecular Alias
200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH
Accession
P12036
Expression Sequence
Protein sequence(P12036, Met1-Gln100, with C-10*His)
MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 11.5kDa
Actual: 11-30kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.