All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HNFHH-25 (for 25μg)

Cat. No.: HNFHH-50 (for 50μg)

Cat. No.: HNFHH-100 (for 100μg)

Description

Neurofilament heavy polypeptide (NEFH) is a protein encoded by the NEFH gene in humans. This gene produces a heavy subunit protein that, along with medium and light subunits, forms neurofilaments. These neurofilaments constitute the structural framework of nerve cells. Mutations in the NEFH gene are linked to Charcot-Marie-Tooth disease. NEFH is crucial for the formation of the neuronal cytoskeleton, and polymorphisms in this gene are identified as a rare cause of sporadic amyotrophic lateral sclerosis (sALS).

Species

Human

Molecular Alias

200 kDa neurofilament protein; Neurofilament triplet H protein; NEFH; KIAA0845; NFH

Accession

P12036

Expression Sequence

Protein sequence(P12036, Met1-Gln100, with C-10*His)

MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCMVAVATSRSEKEQGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 11.5kDa 

Actual: 11-30kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.