thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human Myoglobin, His Tag

Human Myoglobin, His Tag

$280.00 - $2,464.00
$3,080.00
Myoglobin (symbol Mb or MB) is an iron- and oxygen-binding protein found in the cardiac and skeletal muscle tissue of vertebrates, including nearly all mammals. It is distantly related to hemoglobin but differs in that it has a higher affinity for oxygen and does not exhibit cooperative binding with oxygen as hemoglobin does. In humans, myoglobin is present in the bloodstream only after muscle injury, making it a sensitive marker for such injuries. This sensitivity allows myoglobin to be a potential marker for heart attacks in patients with chest pain. However, elevated myoglobin levels have low specificity for acute myocardial infarction (AMI). Therefore, CK-MB, cardiac troponin, ECG, and clinical signs should also be considered for an accurate diagnosis.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HMGH-50 (for 50μg)

Cat. No.: HMGH-100 (for 100μg)

Cat. No.: HMGH-500 (for 500μg)

 

 

Description

Myoglobin (symbol Mb or MB) is an iron- and oxygen-binding protein found in the cardiac and skeletal muscle tissue of vertebrates, including nearly all mammals. It is distantly related to hemoglobin but differs in that it has a higher affinity for oxygen and does not exhibit cooperative binding with oxygen as hemoglobin does. In humans, myoglobin is present in the bloodstream only after muscle injury, making it a sensitive marker for such injuries. This sensitivity allows myoglobin to be a potential marker for heart attacks in patients with chest pain. However, elevated myoglobin levels have low specificity for acute myocardial infarction (AMI). Therefore, CK-MB, cardiac troponin, ECG, and clinical signs should also be considered for an accurate diagnosis.

 

Species

Human

 

Molecular Alias

symbol Mb, MB

 

Accession

P02144

 

Expression Sequence

Protein sequence (P02144, Met1-Gly154 with C-10*His)

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGGGGGSHHHHHHHHHH

 

Expression Host

E.coli

 

Molecular Weight

Theoretical: 18.8kDa 

Actual: 20kDa

 

Purity

95% by SDS-PAGE

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Liquid

 

Storage Conditions

12 months from the date of receipt at -20°C as supplied.


 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More