thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human Lumican, His tag

Human Lumican, His tag

$140.00 - $448.00
$560.00
Lumican is a member of the small leucine-rich proteoglycan family, found in various extracellular matrices of tissues such as muscle, cartilage, and cornea. In the skin, lumican is present as a glycoprotein and plays a critical role in collagen fibrillogenesis, as demonstrated by gene knockout studies in mice. A direct link between lumican expression and melanoma progression and metastasis has been established. Lumican impedes tumor cell migration and invasion by directly interacting with the α2β1 integrin. Additionally, an active sequence of the lumican core protein, known as lumcorin, has been identified as responsible for inhibiting melanoma cell migration. Lumican also exhibits angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HLMCH-25 (for 25μg)

Cat. No.: HLMCH-50 (for 50μg)

Cat. No.: HLMCH-100 (for 100μg)

 

 

Description

Lumican is a member of the small leucine-rich proteoglycan family, found in various extracellular matrices of tissues such as muscle, cartilage, and cornea. In the skin, lumican is present as a glycoprotein and plays a critical role in collagen fibrillogenesis, as demonstrated by gene knockout studies in mice. A direct link between lumican expression and melanoma progression and metastasis has been established. Lumican impedes tumor cell migration and invasion by directly interacting with the α2β1 integrin. Additionally, an active sequence of the lumican core protein, known as lumcorin, has been identified as responsible for inhibiting melanoma cell migration. Lumican also exhibits angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9.

 

Species

Human

 

Molecular Alias

Keratan sulfate proteoglycan lumican (KSPG lumican)

 

Accession

P51884

 

Expression Sequence

Protein sequence(P51884, Gln19-Asn338, with C-10*His)

QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 38.3kDa 

Actual: 46kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More