All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HLMCH-25 (for 25μg)

Cat. No.: HLMCH-50 (for 50μg)

Cat. No.: HLMCH-100 (for 100μg)

Description

Lumican is a member of the small leucine-rich proteoglycan family, found in various extracellular matrices of tissues such as muscle, cartilage, and cornea. In the skin, lumican is present as a glycoprotein and plays a critical role in collagen fibrillogenesis, as demonstrated by gene knockout studies in mice. A direct link between lumican expression and melanoma progression and metastasis has been established. Lumican impedes tumor cell migration and invasion by directly interacting with the α2β1 integrin. Additionally, an active sequence of the lumican core protein, known as lumcorin, has been identified as responsible for inhibiting melanoma cell migration. Lumican also exhibits angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9.

Species

Human

Molecular Alias

Keratan sulfate proteoglycan lumican (KSPG lumican)

Accession

P51884

Expression Sequence

Protein sequence(P51884, Gln19-Asn338, with C-10*His)

QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 38.3kDa 

Actual: 46kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Label

Unconjugated

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.