
Human Lumican, His tag
$140.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HLMCH-25 (for 25μg)
Cat. No.: HLMCH-50 (for 50μg)
Cat. No.: HLMCH-100 (for 100μg)
Description
Lumican is a member of the small leucine-rich proteoglycan family, found in various extracellular matrices of tissues such as muscle, cartilage, and cornea. In the skin, lumican is present as a glycoprotein and plays a critical role in collagen fibrillogenesis, as demonstrated by gene knockout studies in mice. A direct link between lumican expression and melanoma progression and metastasis has been established. Lumican impedes tumor cell migration and invasion by directly interacting with the α2β1 integrin. Additionally, an active sequence of the lumican core protein, known as lumcorin, has been identified as responsible for inhibiting melanoma cell migration. Lumican also exhibits angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9.
Species
Human
Molecular Alias
Keratan sulfate proteoglycan lumican (KSPG lumican)
Accession
P51884
Expression Sequence
Protein sequence(P51884, Gln19-Asn338, with C-10*His)
QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 38.3kDa
Actual: 46kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Label
Unconjugated
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt, at -20 to -70 °C as supplied.
1 month, at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.










