thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Achievements
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Achievements
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human Lambda, His tag

Human Lambda, His tag

$168.00 - $448.00
$560.00
The immunoglobulin light chain is the smaller polypeptide subunit of an antibody (immunoglobulin). In humans, there are two types of light chains: kappa (κ) chains and lambda (λ) chains. Each individual B-cell in lymphoid tissue possesses either kappa or lambda light chains, but never both concurrently. Rearrangement of specific lambda light chain genes in immunoglobulins can result in the loss of certain protein coding genes. Immunohistochemistry enables the determination of the relative abundance of B-cells expressing kappa and lambda light chains. In reactive or benign lymph nodes or similar tissues, a mixture of kappa-positive and lambda-positive cells should be present. However, if one type of light chain is significantly more prevalent than the other, the cells may all derive from a small clonal population, suggesting a malignant condition such as B-cell lymphoma.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HLBDH-25 (for 25μg)

Cat. No.: HLBDH-50 (for 50μg)

Cat. No.: HLBDH-100 (for 100μg)

 

 

Description

The immunoglobulin light chain is the smaller polypeptide subunit of an antibody (immunoglobulin). In humans, there are two types of light chains: kappa (κ) chains and lambda (λ) chains. Each individual B-cell in lymphoid tissue possesses either kappa or lambda light chains, but never both concurrently. Rearrangement of specific lambda light chain genes in immunoglobulins can result in the loss of certain protein coding genes. Immunohistochemistry enables the determination of the relative abundance of B-cells expressing kappa and lambda light chains. In reactive or benign lymph nodes or similar tissues, a mixture of kappa-positive and lambda-positive cells should be present. However, if one type of light chain is significantly more prevalent than the other, the cells may all derive from a small clonal population, suggesting a malignant condition such as B-cell lymphoma.

 

Species

Human

 

Accession

P0CG04

 

Expression Sequence

Protein sequence(P0CG04, Gly1-Ser106, with C-10*His)

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 13kDa 

Actual: 17kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

 

Reconstitution Method

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • Precision Molecular Tools

    from Research to Commercial Scale

    For over 25 years, SBS Genetech has delivered

    high-purity, rigorously validated molecular reagents

    trusted by leading research institutions and

    biotechnology companies across 60+ countries.

    Explore Products
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More