All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HLBDH-25 (for 25μg)

Cat. No.: HLBDH-50 (for 50μg)

Cat. No.: HLBDH-100 (for 100μg)

Description

The immunoglobulin light chain is the smaller polypeptide subunit of an antibody (immunoglobulin). In humans, there are two types of light chains: kappa (κ) chains and lambda (λ) chains. Each individual B-cell in lymphoid tissue possesses either kappa or lambda light chains, but never both concurrently. Rearrangement of specific lambda light chain genes in immunoglobulins can result in the loss of certain protein coding genes. Immunohistochemistry enables the determination of the relative abundance of B-cells expressing kappa and lambda light chains. In reactive or benign lymph nodes or similar tissues, a mixture of kappa-positive and lambda-positive cells should be present. However, if one type of light chain is significantly more prevalent than the other, the cells may all derive from a small clonal population, suggesting a malignant condition such as B-cell lymphoma.

Species

Human

Accession

P0CG04

Expression Sequence

Protein sequence(P0CG04, Gly1-Ser106, with C-10*His)

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 13kDa 

Actual: 17kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Label

Unconjugated

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.