thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human IgG1 Fc, His tag

Human IgG1 Fc, His tag

$168.00 - $448.00
$560.00
The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction allows antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HI1FH-25 (for 25μg)

Cat. No.: HI1FH-50 (for 50μg)

Cat. No.: HI1FH-100 (for 100μg)

 

 

Description

The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction allows antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.

 

Species

Human

 

Molecular Alias

Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1

 

Accession

P01857

 

Expression Sequence

Protein sequence(P01857, Asp104-Lys330(D239E,L241E), with C-10*His)

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 27.2kDa 

Actual: 30kDa

 

Purity

>90% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More