
Human IgG1 Fc, His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HI1FH-25 (for 25μg)
Cat. No.: HI1FH-50 (for 50μg)
Cat. No.: HI1FH-100 (for 100μg)
Description
The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction allows antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.
Species
Human
Molecular Alias
Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1
Accession
P01857
Expression Sequence
Protein sequence(P01857, Asp104-Lys330(D239E,L241E), with C-10*His)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 27.2kDa
Actual: 30kDa
Purity
>90% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.