All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HI1F-25 (for 25μg)

Cat. No.: HI1F-50 (for 50μg)

Cat. No.: HI1F-100 (for 100μg)

Description

The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors called Fc receptors and certain proteins in the complement system. This interaction allows antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.

Species

Human

Molecular Alias

Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1

Accession

P01857

Expression Sequence

Protein sequence(P01857, Asp104-Lys330(D239E,L241E), no tag)

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression Host

HEK293

Molecular Weight

Theoretical: 25.5kDa 

Actual: 30kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

N/A

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.