thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human h-FABP3, His Tag

Human h-FABP3, His Tag

$630.00 - $3,528.00
$4,410.00
Heart-type fatty acid-binding protein (hFABP), also known as mammary-derived growth inhibitor, is encoded by the FABP3 gene in humans. H-FABP is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. It serves as a sensitive biomarker for myocardial infarction, detectable in the blood within one to three hours of the onset of chest pain. Beyond its diagnostic utility, H-FABP holds significant prognostic value. Among various cardiac biomarkers, including D-dimer, NT-proBNP, and peak troponin T, H-FABP stands out as a statistically significant predictor of death or myocardial infarction within one year. This prognostic capability is independent of troponin T levels, ECG findings, and clinical examinations.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HHF3H-50 (for 50μg)

Cat. No.: HHF3H-100 (for 100μg)

Cat. No.: HHF3H-500 (for 500μg)

 

 

Description

Heart-type fatty acid-binding protein (hFABP), also known as mammary-derived growth inhibitor, is encoded by the FABP3 gene in humans. H-FABP is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. It serves as a sensitive biomarker for myocardial infarction, detectable in the blood within one to three hours of the onset of chest pain. Beyond its diagnostic utility, H-FABP holds significant prognostic value. Among various cardiac biomarkers, including D-dimer, NT-proBNP, and peak troponin T, H-FABP stands out as a statistically significant predictor of death or myocardial infarction within one year. This prognostic capability is independent of troponin T levels, ECG findings, and clinical examinations.

 

Species

Human

 

Molecular Alias

Fatty acid-binding protein 3, Heart-type fatty acid-binding protein (H-FABP), Mammary-derived growth inhibitor (MDGI), Muscle fatty acid-binding protein (M-FABP)

 

Accession

P05413

 

Expression Sequence

Protein sequence(P05413, Met1-Ala133 with C-10*His)

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH

 

Expression Host

E.coli

 

Molecular Weight

Theoretical: 16.5kDa 

Actual: 18kDa

 

Purity

95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More