
Human h-FABP3, His Tag
$630.00 - $3,528.00
$4,410.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HHF3H-50 (for 50μg)
Cat. No.: HHF3H-100 (for 100μg)
Cat. No.: HHF3H-500 (for 500μg)
Description
Heart-type fatty acid-binding protein (hFABP), also known as mammary-derived growth inhibitor, is encoded by the FABP3 gene in humans. H-FABP is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. It serves as a sensitive biomarker for myocardial infarction, detectable in the blood within one to three hours of the onset of chest pain. Beyond its diagnostic utility, H-FABP holds significant prognostic value. Among various cardiac biomarkers, including D-dimer, NT-proBNP, and peak troponin T, H-FABP stands out as a statistically significant predictor of death or myocardial infarction within one year. This prognostic capability is independent of troponin T levels, ECG findings, and clinical examinations.
Species
Human
Molecular Alias
Fatty acid-binding protein 3, Heart-type fatty acid-binding protein (H-FABP), Mammary-derived growth inhibitor (MDGI), Muscle fatty acid-binding protein (M-FABP)
Accession
P05413
Expression Sequence
Protein sequence(P05413, Met1-Ala133 with C-10*His)
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH
Expression Host
E.coli
Molecular Weight
Theoretical: 16.5kDa
Actual: 18kDa
Purity
95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Label
Unconjugated
Tag
His Tag
Form
Lyophilized Powder
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt, at -20 to -70 °C as supplied.
1 month, at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.