
Human GZMB, His tag
$168.00 - $448.00
$560.00
Beyond its primary role in inducing apoptosis, granzyme B boasts a myriad of secondary functions. It has been implicated in instigating inflammation by eliciting cytokine release and partaking in extracellular matrix remodeling, thereby underlining its multifaceted involvement in immune regulation and tissue homeostasis.
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HGZMBH-25 (for 25μg)
Cat. No.: HGZMBH-50 (for 50μg)
Cat. No.: HGZMBH-100 (for 100μg)
Description
Granzyme B (GZMB) stands as a prominent serine protease primarily localized within the granules of natural killer (NK) cells and cytotoxic T cells. This enzyme, alongside the pore-forming protein perforin, is deployed by these immune cells to orchestrate apoptosis in target cells. Interestingly, granzyme B isn't confined solely to cytotoxic cells; it's also synthesized by a diverse array of non-cytotoxic cells spanning from basophils and mast cells to smooth muscle cells.
Beyond its primary role in inducing apoptosis, granzyme B boasts a myriad of secondary functions. It has been implicated in instigating inflammation by eliciting cytokine release and partaking in extracellular matrix remodeling, thereby underlining its multifaceted involvement in immune regulation and tissue homeostasis.
Species
Human
Molecular Alias
C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB
Accession
P10144
Expression Sequence
Protein sequence(P10144, Gly19-Tyr247, with C-10*His)
GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 27.4kDa
Actual: 33kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.