
Human Calprotectin (S100A8), His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HS1A8H-25 (for 25μg)
Cat. No.: HS1A8H-50 (for 50μg)
Cat. No.: HS1A8H-100 (for 100μg)
Description
S100A8 is a member of the S100 family of proteins, characterized by two EF-hand calcium-binding motifs. These proteins are found in the cytoplasm and/or nucleus of a diverse range of cells and play a role in regulating various cellular processes, including cell cycle progression and differentiation. The S100 gene family consists of at least 13 members clustered on chromosome 1q21. S100A8 may function in inhibiting casein kinase and acting as a cytokine. Altered expression of S100A8 has been linked to diseases such as cystic fibrosis and post-COVID-19 condition.
Species
Human
Molecular Alias
Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession
P05109
Expression Sequence
Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH
Expression Host
E.coli
Molecular Weight
Predicted MW: 12.5 kDa
Observed MW: 13.0 kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.










