All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HBST2H-25 (for 25μg)

Cat. No.: HBST2H-50 (for 50μg)

Cat. No.: HBST2H-100 (for 100μg)

Description

Tetherin, also known as bone marrow stromal antigen 2, is encoded by the BST2 gene in humans. It's a versatile protein with roles in various cellular processes. Constitutively expressed in mature B cells, plasma cells, and plasmacytoid dendritic cells, tetherin responds to IFN pathway stimuli in other cell types.

This protein serves as a Type-I-IFN biomarker, particularly notable in flow cytometry analyses. In systemic lupus erythematosus, B cell tetherin acts as a Cell-Specific Assay for Response to Type I Interferon, offering insights into disease features and flares.

Moreover, tetherin's involvement in cell adhesion and migration has been suggested. Recent studies highlight its role in stabilizing lipid rafts by clustering nearby rafts, impacting cellular functions.

Tetherin exhibits a dual role in viral infections. It impedes the budding and cell-to-cell transmission of certain viruses like Dengue virus. However, for human cytomegalovirus (HCMV), tetherin promotes viral entry, especially during cell differentiation. Additionally, tetherin is incorporated into newly formed virions, further influencing viral dynamics.

Species

Human

Molecular Alias

HM1.24 antigen, Tetherin, CD317

Accession

Q10589

Expression Sequence

Protein sequence(Q10589, Asn49-Ser161, with C-10*His)

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 14.3kDa 

Actual: 18-25kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.