Human BST2, His tag
$168.00 - $448.00
$560.00
This protein serves as a Type-I-IFN biomarker, particularly notable in flow cytometry analyses. In systemic lupus erythematosus, B cell tetherin acts as a Cell-Specific Assay for Response to Type I Interferon, offering insights into disease features and flares.
Moreover, tetherin's involvement in cell adhesion and migration has been suggested. Recent studies highlight its role in stabilizing lipid rafts by clustering nearby rafts, impacting cellular functions.
Tetherin exhibits a dual role in viral infections. It impedes the budding and cell-to-cell transmission of certain viruses like Dengue virus. However, for human cytomegalovirus (HCMV), tetherin promotes viral entry, especially during cell differentiation. Additionally, tetherin is incorporated into newly formed virions, further influencing viral dynamics.
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HBST2H-25 (for 25μg)
Cat. No.: HBST2H-50 (for 50μg)
Cat. No.: HBST2H-100 (for 100μg)
Description
Tetherin, also known as bone marrow stromal antigen 2, is encoded by the BST2 gene in humans. It's a versatile protein with roles in various cellular processes. Constitutively expressed in mature B cells, plasma cells, and plasmacytoid dendritic cells, tetherin responds to IFN pathway stimuli in other cell types.
This protein serves as a Type-I-IFN biomarker, particularly notable in flow cytometry analyses. In systemic lupus erythematosus, B cell tetherin acts as a Cell-Specific Assay for Response to Type I Interferon, offering insights into disease features and flares.
Moreover, tetherin's involvement in cell adhesion and migration has been suggested. Recent studies highlight its role in stabilizing lipid rafts by clustering nearby rafts, impacting cellular functions.
Tetherin exhibits a dual role in viral infections. It impedes the budding and cell-to-cell transmission of certain viruses like Dengue virus. However, for human cytomegalovirus (HCMV), tetherin promotes viral entry, especially during cell differentiation. Additionally, tetherin is incorporated into newly formed virions, further influencing viral dynamics.
Species
Human
Molecular Alias
HM1.24 antigen, Tetherin, CD317
Accession
Q10589
Expression Sequence
Protein sequence(Q10589, Asn49-Ser161, with C-10*His)
NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 14.3kDa
Actual: 18-25kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.