thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • LAMP
    • RPA
    • CRISPR
    • Pathogen Detection
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • Synbio 
    • Synthetic Biology
    • NMN
    • Ambroxan
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • LAMP
      • RPA
      • CRISPR
      • Pathogen Detection
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • Synbio 
      • Synthetic Biology
      • NMN
      • Ambroxan
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human BST2, His tag

Human BST2, His tag

$168.00 - $448.00
$560.00
Tetherin, also known as bone marrow stromal antigen 2, is encoded by the BST2 gene in humans. It's a versatile protein with roles in various cellular processes. Constitutively expressed in mature B cells, plasma cells, and plasmacytoid dendritic cells, tetherin responds to IFN pathway stimuli in other cell types.

This protein serves as a Type-I-IFN biomarker, particularly notable in flow cytometry analyses. In systemic lupus erythematosus, B cell tetherin acts as a Cell-Specific Assay for Response to Type I Interferon, offering insights into disease features and flares.

Moreover, tetherin's involvement in cell adhesion and migration has been suggested. Recent studies highlight its role in stabilizing lipid rafts by clustering nearby rafts, impacting cellular functions.

Tetherin exhibits a dual role in viral infections. It impedes the budding and cell-to-cell transmission of certain viruses like Dengue virus. However, for human cytomegalovirus (HCMV), tetherin promotes viral entry, especially during cell differentiation. Additionally, tetherin is incorporated into newly formed virions, further influencing viral dynamics.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HBST2H-25 (for 25μg)

Cat. No.: HBST2H-50 (for 50μg)

Cat. No.: HBST2H-100 (for 100μg)

 

 

Description

Tetherin, also known as bone marrow stromal antigen 2, is encoded by the BST2 gene in humans. It's a versatile protein with roles in various cellular processes. Constitutively expressed in mature B cells, plasma cells, and plasmacytoid dendritic cells, tetherin responds to IFN pathway stimuli in other cell types.

This protein serves as a Type-I-IFN biomarker, particularly notable in flow cytometry analyses. In systemic lupus erythematosus, B cell tetherin acts as a Cell-Specific Assay for Response to Type I Interferon, offering insights into disease features and flares.

Moreover, tetherin's involvement in cell adhesion and migration has been suggested. Recent studies highlight its role in stabilizing lipid rafts by clustering nearby rafts, impacting cellular functions.

Tetherin exhibits a dual role in viral infections. It impedes the budding and cell-to-cell transmission of certain viruses like Dengue virus. However, for human cytomegalovirus (HCMV), tetherin promotes viral entry, especially during cell differentiation. Additionally, tetherin is incorporated into newly formed virions, further influencing viral dynamics.

 

Species

Human

 

Molecular Alias

HM1.24 antigen, Tetherin, CD317

 

Accession

Q10589

 

Expression Sequence

Protein sequence(Q10589, Asn49-Ser161, with C-10*His)

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 14.3kDa 

Actual: 18-25kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More