All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HATF4H-25 (for 25μg)

Cat. No.: HATF4H-50 (for 50μg)

Cat. No.: HATF4H-100 (for 100μg)

Description

Activating transcription factor 4 (tax-responsive enhancer element B67), commonly known as ATF4, is a protein encoded by the ATF4 gene in humans. Originally identified as a widely expressed mammalian DNA binding protein capable of binding a tax-responsive enhancer element in the LTR of HTLV-1, ATF4 was later characterized as the cAMP-response element binding protein 2 (CREB-2). While ATF4 itself is not a functional transcription factor, it often forms heterodimeric transcription factors. Belonging to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs), and CREB-like proteins, ATF4 plays a significant role in various cellular processes. Additionally, ATF4 is known to contribute to osteoblast differentiation alongside RUNX2 and osterix.

Species

Human

Molecular Alias

Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67, TaxREB67, TXREB

Accession

P18848

Expression Sequence

Protein sequence(P18848, Phe20-Tyr200, with C-10*His)

FDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKP

Expression Host

HEK293

Molecular Weight

Theoretical: 21.4kDa 

Actual: 29kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.