
Human ANGPTL3,His tag
$168.00 - $448.00
$560.00
All products have special prices for bulk purchase, please contact us for more details if required.
Cat. No.: HAG3H-25 (for 25μg)
Cat. No.: HAG3H-50 (for 50μg)
Cat. No.: HAG3H-100 (for 100μg)
Description
Angiopoietin-like 3 (ANGPTL3) is a member of the angiopoietin-like family of secreted factors, predominantly expressed in the liver. It shares the characteristic structure of angiopoietins, consisting of a signal peptide, an N-terminal coiled-coil domain, and a C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in ANGPTL3 binds to alpha-5/beta-3 integrins, inducing endothelial cell adhesion and migration, suggesting a role in the regulation of angiogenesis. Additionally, ANGPTL3 functions as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), thereby increasing plasma levels of triglycerides, LDL cholesterol, and HDL cholesterol in both mice and humans.
Species
Human
Molecular Alias
Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5), Angiopoietin-like protein 3, ANGPT5
Accession
Q9Y5C1
Expression Sequence
Protein sequence(Q9Y5C1, Ser17-Glu460, with C-10*His)
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEGGGGSHHHHHHHHHH
Expression Host
HEK293
Molecular Weight
Theoretical: 53.4kDa
Actual: 70kDa
Purity
>95% by SDS-PAGE
Endotoxin content
<1 EU/μg
Tag
His Tag
Form
Lyophilized Powder
Buffer System
Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Method
Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Storage Conditions
12 months from the date of receipt when stored at -20 to -70 °C as supplied.
6 months at -20 to -70 °C under sterile conditions after reconstitution.
1 week at 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.