All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HAG3H-25 (for 25μg)

Cat. No.: HAG3H-50 (for 50μg)

Cat. No.: HAG3H-100 (for 100μg)

Description

Angiopoietin-like 3 (ANGPTL3) is a member of the angiopoietin-like family of secreted factors, predominantly expressed in the liver. It shares the characteristic structure of angiopoietins, consisting of a signal peptide, an N-terminal coiled-coil domain, and a C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in ANGPTL3 binds to alpha-5/beta-3 integrins, inducing endothelial cell adhesion and migration, suggesting a role in the regulation of angiogenesis. Additionally, ANGPTL3 functions as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), thereby increasing plasma levels of triglycerides, LDL cholesterol, and HDL cholesterol in both mice and humans.

Species

Human

Molecular Alias

Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5), Angiopoietin-like protein 3, ANGPT5

Accession

Q9Y5C1

Expression Sequence

Protein sequence(Q9Y5C1, Ser17-Glu460, with C-10*His)

SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 53.4kDa 

Actual: 70kDa

Purity

＞95% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.