All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HAATH-10 (for 10μg)

Cat. No.: HAATH-25 (for 25μg)

Cat. No.: HAATH-50 (for 50μg)

Cat. No.: HAATH-100 (for 100μg)

Cat. No.: HAATH-500 (for 500μg)

Cat. No.: HAATH-1k (for 1mg)

Description

Alpha-1 antitrypsin (A1AT), also known as α1-antitrypsin, A1A, or AAT, is a protein in the serpin superfamily that functions as an enzyme inhibitor. It primarily protects tissues from enzymes released by inflammatory cells, particularly neutrophil elastase. The normal concentration of A1AT in the blood ranges from 0.9 to 2.3 g/L, but this level can increase significantly during acute inflammation.

In cases where the blood has insufficient or defective A1AT, a condition known as alpha-1 antitrypsin deficiency, neutrophil elastase is not properly regulated. This results in the breakdown of elastin, compromising the elasticity of the lungs and leading to respiratory issues.

Additionally, A1AT plays a role in the movement of lymphocytes through tissues. It assists immature T cells as they travel through the thymus, where they mature into immunocompetent T cells. These mature T cells are then released into tissues, enhancing the body's immune response.

Species

Human

Molecular Alias

Alpha-1 protease inhibitor, Alpha-1-antiproteinase, Serpin A1, AAT, PI

Accession

P01009

Expression Sequence

Protein sequence (P01009, Glu25-Lys418, with C-10*His)

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Predicted MW: 46.0 kDa 

Observed MW: 55-70 kDa

Purity

＞95% by SDS-PAGE

Tag

with C-10*His

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.