thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Product 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Synthetic Biology
    • Enzymes
  • POCT Solution 
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Freeze-Drying System
    • Lateral Flow System
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Home
    • Product 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Synthetic Biology
      • Enzymes
    • POCT Solution 
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Freeze-Drying System
      • Lateral Flow System
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human Tau, His Tag

Human Tau, His Tag

$560.00 - $5,712.00
$7,140.00
Tau proteins (abbreviated from tubulin associated unit) are a group of six highly soluble protein isoforms produced by alternative splicing of the MAPT gene (microtubule-associated protein tau). These proteins primarily help maintain the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), with the cerebral cortex having the highest concentration. Hyperphosphorylation of tau proteins (tau inclusions, pTau) can lead to the self-assembly of tangles of paired helical filaments and straight filaments, which are implicated in the pathogenesis of Alzheimer's disease, frontotemporal dementia, and other tauopathies.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HTAUH-50 (for 50μg)

Cat. No.: HTAUH-100 (for 100μg)

Cat. No.: HTAUH-500 (for 500μg)

Cat. No.: HTAUH-1k (for 1mg)

 

 

Description

Tau proteins (abbreviated from tubulin associated unit) are a group of six highly soluble protein isoforms produced by alternative splicing of the MAPT gene (microtubule-associated protein tau). These proteins primarily help maintain the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), with the cerebral cortex having the highest concentration. Hyperphosphorylation of tau proteins (tau inclusions, pTau) can lead to the self-assembly of tangles of paired helical filaments and straight filaments, which are implicated in the pathogenesis of Alzheimer's disease, frontotemporal dementia, and other tauopathies.

 

Species

Human

 

Molecular Alias

Neurofibrillary tangle protein, Paired helical filament-tau (PHF-tau)

 

Accession

P10636-2

 

Expression Sequence

Protein sequence(P10636-2, Met1-Gln186 with C-10*His)

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQGGGGSHHHHHHHHHH

 

Expression Host

E.coli

 

Molecular Weight

Theoretical: 20.9kDa 

Actual: 29kDa

 

Purity

95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2025

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More