thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Natural Compounds
    • Enzymes
  • POCT 
    • 6 POCT Platforms
    • LAMP
    • RPA
    • CRISPR
    • Freeze-Drying System
    • Lateral Flow System
    • DNA-Free Enzymes
    • Pathogen Detection
  • Synbio 
    • Synthetic Biology
    • NMN
    • SBS Insights
  • About 
    • About SBS
    • Achievements
    • Ecosystem
    • Legal Statement
  • Contact
  • …  
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Natural Compounds
      • Enzymes
    • POCT 
      • 6 POCT Platforms
      • LAMP
      • RPA
      • CRISPR
      • Freeze-Drying System
      • Lateral Flow System
      • DNA-Free Enzymes
      • Pathogen Detection
    • Synbio 
      • Synthetic Biology
      • NMN
      • SBS Insights
    • About 
      • About SBS
      • Achievements
      • Ecosystem
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Amyloid β Peptide(42-1) human

Amyloid β Peptide(42-1) human

$80.00 - $1,130.00
Amyloid β Peptide(42-1) is the reverse of Amyloid β Peptide(1-42). Inactive control peptide for amyloid β Peptide(1-42).
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact for more details if required.

 

Cat. No.: BA421-0.2 (for 0.2mg)

Cat. No.: BA421-1 (for 1mg)

Cat. No.: BA421-5 (for 5mg)

 

 

Alternative names    

β-Amyloid(42-1);Aβ(42-1)

 

Description    

Amyloid β Peptide(42-1) is the reverse of Amyloid β Peptide(1-42). Inactive control peptide for amyloid β Peptide(1-42).

 

Purity    

>95%(HPLC)

 

CAS Number    

317366-82-8
 

Molecular Formula    

C203H311N55O60S

 

Molecular Weight    

4514.1

 

Sequence

(Three-Letter Code)    Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp
Sequence

(One-Letter Code)    AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

 

Source    

Synthetic

 

Reconstitution    

Resuspend in any one of the following solvents: 1% NH4OH, 50mM Tris/150mM NaCl(pH 7.2),0.1% TFA, 5mM HCl, 2mM NaOH, at a concentration of 1mg/ml or less. DMSO may have high solubility. Sonicate for 30 seconds to 1 minute after it has gone into solution. Gently vortex to mix. To bring into your solution: After resuspension, add 5x or 10x buffer stock (PBS, TBS) and water to bring to 1x buffer.Do not store in 1% NH4OH, dilute immediately with PBS. Notes: Above are relevant information that may provide a guideline on how to dissolve this peptide. Solubility may vary from batch to batch due to solvent of crystallization, residual solvent content, polymorphism, salt versus free form, degree of hydration, solvent temperature, and dissolved oxygen. End users need to test the solvents & solubility and adapt to their own specific applications.

 

Storage

Store at -20°C or below, valid for at least one year. Since each freeze-thaw cycle of the peptide can cause partial inactivation, after preparing the corresponding concentration of storage solution for the first time (please prepare the storage solution according to the information in the Reconstitution section of the product description), it should be aliquoted and stored at -20°C or below to avoid repeated freeze-thaw cycles.

 

Notes

  • This product is a lyophilized powder. Due to the deposition of trace amounts of peptides inside the vial during the lyophilization process, a thin or invisible layer of peptides may form. Therefore, before opening the vial, we recommend centrifuging at approximately 8,000-12,000g for 10-30 seconds in a centrifuge to collect the peptides adhered to the vial cap or wall at the bottom of the vial.
  • This product is intended for scientific research by professionals only and should not be used for clinical diagnosis or treatment, food or drugs, and should not be stored in a regular household.
  • For your safety and health, please wear laboratory attire and disposable gloves while handling.

 

Related:

  • Amyloid β Peptide(1-42) human
  • Amyloid β Peptide(42-1) human
  • Amyloid β Peptide(1-40) human
  • Amyloid β Peptide(40-1) human

 

SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.

 

 

 

Only for research and not intended for treatment of humans or animals

 

 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • background image
    background image
    background image
    background image
    background image
    background image
    background image
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

    Congratulations to Our Customer! Ultra-Sensitive HPV DNA Detection Method Published in Biosensors and Bioelectronics (IF: 11)
    March 20, 2026
    Human papillomavirus (HPV) is a group of non-enveloped, double-stranded DNA viruses strongly...
    Read more...
    Congratulations to Our Customer! Marine Microbial Degradation of SCCPs Revealed in Water Research (IF: 12)
    January 9, 2026
    Short-chain chlorinated paraffins (SCCPs), a class of persistent organic pollutants (POPs), pose...
    Read more...
    Congratulations to Our Customer! Breakthrough Research on HOXB3 Condensation as a Potential Target in Glioblastoma Published in Nature Cell Biology (IF 19)
    November 5, 2025
    Glioblastoma (GBM) remains one of the most aggressive and lethal primary brain tumors in adults,...
    Read more...
    More Posts

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More