Agouti-related Protein(AGRP)(83-132)Amide(human)
$1,904.00 - $2,744.00
$3,430.00
All products have special prices for bulk purchase, please contact for more details if required.
Cat. No.: AGRPH-5 (for 5mg)
Cat. No.: AGRPH-10 (for 10mg)
Cat. No.: AGRPH-50 (for 50mg)
Cat. No.: AGRPH-100 (for 100mg)
English Name: Agouti-related Protein(AGRP)(83-132)Amide(human)
Single Letter Amino Acid Sequence:
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Cys1&Cys4, Cys2&Cys6, Cys3&Cys9, Cys5&Cys10)
Three Letter Amino Acid Sequence:
Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (Cys1&Cys4, Cys2&Cys6, Cys3&Cys9, Cys5&Cys10, Cys7&Cys8)
Amino Acids Count: 50
Molecular Formula: C235H372N76O67S11
Average Molecular Weight: 5686.7227
Isoelectric Point (pI): 8.49
Net Charge at pH 7.0: 5.65
Average Hydrophilicity: Hydrophilic
Appearance: White powdery solid
Source: Synthetic, for scientific research use only, not for human use.
Purity: 95%, 98%
Salt Form Options: TFA, HAC, HCl, or others
Storage Conditions: -20°C to -80°C
SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.
Only for research and not intended for treatment of humans or animals
Journals Using SBS Genetech Products Universities Using SBS Genetech Products
SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory