All products have special prices for bulk purchase, please contact for more details if required.

Cat. No.: TAUH-5 (for 5mg)

Cat. No.: TAUH-10 (for 10mg)

Cat. No.: TAUH-50 (for 50mg)

Cat. No.: TAUH-100 (for 100mg)

English Name: Tau Peptide(255-314)(Repeat 2 Domain)(human)
CAS Number: 2022995-68-0

Single Letter Amino Acid Sequence:
H2N-NVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVD-OH

Three Letter Amino Acid Sequence:
H2N-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-Val-Gln-Ile-Ile-Asn-Lys-Lys-Leu-Asp-Leu-Ser-Asn-Val-Gln-Ser-Lys-Cys-Gly-Ser-Lys-Asp-Asn-Ile-Lys-His-Val-Pro-Gly-Gly-Gly-Ser-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-COOH

Amino Acids Count: 60

Molecular Formula: C277H467N83O86S1
Average Molecular Weight: 6368.24
Exact Molecular Weight: 6364.44

Isoelectric Point (pI): 10.83
Net Charge at pH 7.0: 8.42

Average Hydrophilicity: 0.30408163265306
Hydrophobicity Value: -0.66

Extinction Coefficient: 1490

Source: Synthetic, for scientific research use only, not for human use.
Storage Conditions: -20°C to -80°C

SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.

Only for research and not intended for treatment of humans or animals

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory