
(Asp56)-Parathyroid Hormone(1-84)(rat) | 89899-56-9
$2,464.00 - $3,920.00
$4,900.00
All products have special prices for bulk purchase, please contact for more details if required.
Cat. No.: PTHR-5 (for 5mg)
Cat. No.: PTHR-10 (for 10mg)
Cat. No.: PTHR-50 (for 50mg)
Cat. No.: PTHR-100 (for 100mg)
English Name: (Asp56)-Parathyroid Hormone(1-84)(rat)
CAS Number: 89899-56-9
Single Letter Amino Acid Sequence:
H2N-AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEDNVLVDGN-OH
Three Letter Amino Acid Sequence:
H2N-Ala-Ile-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ser-Leu-Gly-Val-Gln-Met-Ala-Ala-Arg-Glu-Gln-Ser-Tyr-Gln-Arg-Pro-Thr-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Asp-Gly-Asn-COOH
Amino Acids Count: 63
Molecular Formula: C313H510N96O93S3
Average Molecular Weight: 7202.18
Exact Molecular Weight: 7197.73
Isoelectric Point (pI): 10.37
Net Charge at pH 7.0: 3.69
Acidic Residues Count: pH 7.0 Net Charge: 2.30
Basic Residues Count:
Average Hydrophilicity: 0.1551724137931
Hydrophobicity Value: -0.57
Appearance: White powdery solid
Extinction Coefficient: 6990
Source: Synthetic, for scientific research use only, not for human use.
Purity: 95%, 98%
Salt Form Options: TFA, HAC, HCl, or others
Storage Conditions: -20°C to -80°C
SBS Genetech is recognized as one of the global major leading industry players in Peptide Synthesis by third-party market researchers. For more details, please visit Peptide Synthesis Market 2017-2022 International Outlook, Trends and Analysis.
Only for research and not intended for treatment of humans or animals
Journals Using SBS Genetech Products Universities Using SBS Genetech Products
SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory