thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Solutions
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Solutions
      • Achievements
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Solutions
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Solutions
      • Achievements
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human PCT(Procalcitonin), His Tag

Human PCT(Procalcitonin), His Tag

$630.00 - $3,528.00
$4,410.00
Procalcitonin (PCT) serves as a peptide precursor to the hormone calcitonin. Normally, the level of procalcitonin in the bloodstream of healthy individuals remains below the limit of detection (0.01 µg/L) in clinical assays. However, in response to a pro-inflammatory stimulus, particularly of bacterial origin, the level of procalcitonin rises significantly. This elevation in procalcitonin levels between microbial infections and healthy states has rendered it a valuable marker for enhancing the identification of bacterial infections and guiding antibiotic therapy.
Select
Quantity
Add to cart
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HPCTH-50 (for 50μg)

Cat. No.: HPCTH-100 (for 100μg)

Cat. No.: HPCTH-500 (for 500μg)

 

 

Description

Procalcitonin (PCT) serves as a peptide precursor to the hormone calcitonin. Normally, the level of procalcitonin in the bloodstream of healthy individuals remains below the limit of detection (0.01 µg/L) in clinical assays. However, in response to a pro-inflammatory stimulus, particularly of bacterial origin, the level of procalcitonin rises significantly. This elevation in procalcitonin levels between microbial infections and healthy states has rendered it a valuable marker for enhancing the identification of bacterial infections and guiding antibiotic therapy.

 

Species

Human

 

Molecular Alias

PCT(Procalcitonin)

 

Accession

P01258

 

Expression Sequence

Protein sequence(P01258, Ala26-Asn141 with C-10*His)

MAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQ EREGSSLDSPRSKRCGNLST CMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANGGGGSHHHHHHHHHH 

 

Expression Host

E.coli

 

Molecular Weight

Theoretical: 14.6kDa 

Actual: 15kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Label

Unconjugated

 

Tag

His Tag

 

Form

Lyophilized Powder

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt, at -20 to -70 °C as supplied.

1 month, at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • Precision Molecular Technologies

    from Research to Commercial Scale

    For over 25 years, SBS Genetech has delivered

    high-quality, rigorously validated molecular reagents

    trusted by leading research institutions and

    biotechnology companies across 60+ countries.

    Explore Products
    OEM & Custom Solutions
  • Scientific Validation Behind Our Technologies

    We are honored to create value for our customers and facilitate the development of science

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More