thumbnail image
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Achievements
      • Legal Statement
    • Contact
    • Login
tech@sbsbio.com
Beijing SBS Genetech Co.,Ltd.
Beijing SBS Genetech Co.,Ltd.

from China, for the World

for Superior Biology Services since 2000

  • Home
  • Products 
    • All Products
    • Custom Services
    • Catalog Products
    • Innovative Systems
    • Nucleic Acid Related
    • Enzymes
  • POCT 
    • Integrated POCT Platform
    • LAMP
    • RPA
    • CRISPR
    • DNA-Free Enzymes
    • Lateral Flow System
    • Freeze-Drying System
  • About 
    • About SBS
    • Achievements
    • Legal Statement
  • Contact
  • …  
    • Home
    • Products 
      • All Products
      • Custom Services
      • Catalog Products
      • Innovative Systems
      • Nucleic Acid Related
      • Enzymes
    • POCT 
      • Integrated POCT Platform
      • LAMP
      • RPA
      • CRISPR
      • DNA-Free Enzymes
      • Lateral Flow System
      • Freeze-Drying System
    • About 
      • About SBS
      • Achievements
      • Legal Statement
    • Contact
    • Login
Beijing SBS Genetech Co.,Ltd.
Go Back
Human IgG4 Fc, His tag

Human IgG4 Fc, His tag

$168.00 - $448.00
$560.00
The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction enables antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.
Select
Quantity
Coming soon
Add to cart
More Details

All products have special prices for bulk purchase, please contact us for more details if required.

 

Cat. No.: HI4FH-25 (for 25μg)

Cat. No.: HI4FH-50 (for 50μg)

Cat. No.: HI4FH-100 (for 100μg)

 

 

Description

The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction enables antibodies to activate the immune system. By binding to various cell receptors and complement proteins, the Fc region mediates different physiological effects of antibodies, including the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.

 

Species

Human

 

Molecular Alias

Ig gamma-4 chain C region, IGHG4

 

Accession

P01861

 

Expression Sequence

Protein sequence(P01861, Glu99-Gly326, with C-10*His)

ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSHHHHHHHHHH

 

Expression Host

HEK293

 

Molecular Weight

Theoretical: 27.3kDa 

Actual: 33kDa

 

Purity

>95% by SDS-PAGE

 

Endotoxin content

<1 EU/μg

 

Tag

with C-10*His

 

Form

Lyophilized Powder

 

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

 

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

 

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.


 

 

 

 
 
Only for research and not intended for treatment of humans or animals
 
 

Journals Using SBS Genetech Products                                       Universities Using SBS Genetech Products

 

 

SBS Genetech is a long-term sponsor of Cold Spring Harbor Laboratory

  • Precision Molecular Tools

    from Research to Commercial Scale

    For over 25 years, SBS Genetech has delivered

    high-purity, rigorously validated molecular reagents

    trusted by leading research institutions and

    biotechnology companies across 60+ countries.

    Explore Products
  • Featured Publications

    We are honored to create value for our customers and facilitate the development of science

    Congratulations to Our Customer! Ultra-Sensitive HPV DNA Detection Method Published in Biosensors and Bioelectronics (IF: 11)
    2026年3月20日
    Human papillomavirus (HPV) is a group of non-enveloped, double-stranded DNA viruses strongly...
    Read more...
    Congratulations to Our Customer! Marine Microbial Degradation of SCCPs Revealed in Water Research (IF: 12)
    2026年1月9日
    Short-chain chlorinated paraffins (SCCPs), a class of persistent organic pollutants (POPs), pose...
    Read more...
    Congratulations to Our Customer! Breakthrough Research on HOXB3 Condensation as a Potential Target in Glioblastoma Published in Nature Cell Biology (IF 19)
    2025年11月5日
    Glioblastoma (GBM) remains one of the most aggressive and lethal primary brain tumors in adults,...
    Read more...
    More Posts

SBS Genetech © Copyright 2000-2026

from China, for the World

for Superior Biology Services since 2000

    Home
    Journals
    Contact
    Posts
Cookie Use
We use cookies to ensure a smooth browsing experience. By continuing we assume you accept the use of cookies.
Learn More