All products have special prices for bulk purchase, please contact us for more details if required.

Cat. No.: HI2FH-25 (for 25μg)

Cat. No.: HI2FH-50 (for 50μg)

Cat. No.: HI2FH-100 (for 100μg)

Description

The fragment crystallizable region (Fc region) is the tail part of an antibody that interacts with cell surface receptors known as Fc receptors and certain proteins in the complement system. This interaction enables antibodies to activate the immune system. The Fc region binds to various cell receptors and complement proteins, mediating different physiological effects of antibodies, such as the detection of opsonized particles, cell lysis, and the degranulation of mast cells, basophils, and eosinophils, among other processes.

Species

Human

Molecular Alias

Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE

Accession

P01859

Expression Sequence

Protein sequence(P01859, Glu99-Lys326(V161M, S257A), with C-10*His)

ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH

Expression Host

HEK293

Molecular Weight

Theoretical: 27.4kDa 

Actual: 32kDa

Purity

＞90% by SDS-PAGE

Endotoxin content

<1 EU/μg

Tag

His Tag

Form

Lyophilized Powder

Buffer System

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Method

Reconstitute at no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Storage Conditions

12 months from the date of receipt when stored at -20 to -70 °C as supplied.

6 months at -20 to -70 °C under sterile conditions after reconstitution.

1 week at 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.